![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families) ![]() |
![]() | Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (2 proteins) domain III structure is lacking some of the superfamily characters and is often disordered in crystals |
![]() | Protein Elongation factor 2 (eEF-2) [82677] (2 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82678] (13 PDB entries) Uniprot P32324 |
![]() | Domain d1u2ra4: 1u2r A:482-560 [107620] Other proteins in same PDB: d1u2ra1, d1u2ra2, d1u2ra3 complexed with apr, gdp, mg, so1 |
PDB Entry: 1u2r (more details), 2.6 Å
SCOPe Domain Sequences for d1u2ra4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u2ra4 d.58.11.1 (A:482-560) Elongation factor 2 (eEF-2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} kfsvspvvqvavevknandlpklveglkrlsksdpcvltymsesgehivagtgelhleic lqdlehdhagvplkisppv
Timeline for d1u2ra4:
![]() Domains from same chain: (mouse over for more information) d1u2ra1, d1u2ra2, d1u2ra3, d1u2ra5 |