Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
Protein Myo-inositol 1-phosphate synthase [75105] (4 species) |
Species Archaeoglobus fulgidus [TaxId:2234] [110418] (3 PDB entries) Uniprot O28480 |
Domain d1u1ib1: 1u1i B:401-627,B:733-792 [107584] Other proteins in same PDB: d1u1ia2, d1u1ib2, d1u1ic2, d1u1id2 complexed with k, nad, po4 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1u1i (more details), 1.9 Å
SCOPe Domain Sequences for d1u1ib1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u1ib1 c.2.1.3 (B:401-627,B:733-792) Myo-inositol 1-phosphate synthase {Archaeoglobus fulgidus [TaxId: 2234]} mkvwlvgaygivsttamvgaraiergiapkiglvselphfegiekyapfsfefggheirl lsnayeaakehwelnrhfdreileavksdlegivarkgtalncgsgikelgdiktlegeg lslaemvsrieediksfaddetvvinvasteplpnyseeyhgslegfermidedrkeyas asmlyayaalklglpyanftpspgsaipalkelaekkgvphagndgkXaivaaplildia rfllfakkkgvkgvvkemafffkspmdtnvintheqfvvlkewysnlk
Timeline for d1u1ib1: