SCOP 1.69: Domain d1u0mb1: 1u0m B:2-201

Lineage for d1u0mb1 (1u0m B:2-201)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (2 families)

5. Family c.95.1.2: Chalcone synthase-like [53914] (7 proteins)

6. Protein Putative polyketide synthase SCO1206 [110762] (1 species)

7. Species Streptomyces coelicolor [TaxId:1902] [110763] (1 PDB entry)

8. Domain d1u0mb1: 1u0m B:2-201 [107559]

Details for d1u0mb1

PDB Entry: 1u0m, 2.22 Å

PDB Description: Crystal Structure of 1,3,6,8-Tetrahydroxynaphthalene Synthase (THNS) from Streptomyces coelicolor A3(2): a Bacterial Type III Polyketide Synthase (PKS) Provides Insights into Enzymatic Control of Reactive Polyketide Intermediates

SCOP Domain Sequences for d1u0mb1:

Sequence; same for both SEQRES and ATOM records:

>d1u0mb1 c.95.1.2 (B:2-201) Putative polyketide synthase SCO1206 {Streptomyces coelicolor}
atlcrpsvsvpehvitmeetlelarrrhtdhpqlplalrlientgvrtrhivqpiedtle
hpgfedrnkvyereaksrvpaviqralddaellatdidviiyvsctgfmmpsltawline
mgfdsttrqipiaqlgcaaggaainrahdfctaypeanalivacefcslcyqptdlgvgs
llcnglfgdgiaaavvrgrg

Timeline for d1u0mb1:

• d1u0mb1 is new in SCOP 1.69
  
• d1u0mb1 appears in SCOP 1.71
  
• d1u0mb1 appears in the current release, SCOPe 2.08