Lineage for d1tzyg_ (1tzy G:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2698056Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2698296Protein Histone H3 [47122] (6 species)
  7. 2698382Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47123] (6 PDB entries)
    Uniprot P84229
  8. 2698384Domain d1tzyg_: 1tzy G: [107536]
    Other proteins in same PDB: d1tzya_, d1tzyb_, d1tzyd_, d1tzye_, d1tzyf_, d1tzyh_
    complexed with cl, po4

Details for d1tzyg_

PDB Entry: 1tzy (more details), 1.9 Å

PDB Description: Crystal Structure of the Core-Histone Octamer to 1.90 Angstrom Resolution
PDB Compounds: (G:) histone h3

SCOPe Domain Sequences for d1tzyg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tzyg_ a.22.1.1 (G:) Histone H3 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]}
phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqease
aylvglfedtnlcaihakrvtimpkdiqlarrirgera

SCOPe Domain Coordinates for d1tzyg_:

Click to download the PDB-style file with coordinates for d1tzyg_.
(The format of our PDB-style files is described here.)

Timeline for d1tzyg_: