Class a: All alpha proteins [46456] (290 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) |
Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
Protein Histone H4 [47125] (7 species) |
Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47126] (6 PDB entries) Uniprot P62801 |
Domain d1tzyd_: 1tzy D: [107533] Other proteins in same PDB: d1tzya_, d1tzyb_, d1tzyc_, d1tzye_, d1tzyf_, d1tzyg_ complexed with cl, po4 |
PDB Entry: 1tzy (more details), 1.9 Å
SCOPe Domain Sequences for d1tzyd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tzyd_ a.22.1.1 (D:) Histone H4 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} kvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrk tvtamdvvyalkrqgrtlygfgg
Timeline for d1tzyd_: