Class b: All beta proteins [48724] (144 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
Species Human (Homo sapiens) [TaxId:9606] [88575] (82 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) |
Domain d1tzib2: 1tzi B:114-213 [107490] Other proteins in same PDB: d1tzia1, d1tzia2, d1tzib1, d1tziv_ |
PDB Entry: 1tzi (more details), 2.8 Å
SCOP Domain Sequences for d1tzib2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tzib2 b.1.1.2 (B:114-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)} astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep
Timeline for d1tzib2: