Lineage for d1tzib1 (1tzi B:1-113)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739730Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2739734Species Engineered (including hybrid species) [88562] (67 PDB entries)
    SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # humanized antibody ! SQ NA # Humanized antibody ! SQ NA # engineered antibody
  8. 2739802Domain d1tzib1: 1tzi B:1-113 [107489]
    Other proteins in same PDB: d1tzia1, d1tzia2, d1tzib2, d1tziv_

Details for d1tzib1

PDB Entry: 1tzi (more details), 2.8 Å

PDB Description: Crystal Structure of the Fab YADS2 Complexed with h-VEGF
PDB Compounds: (B:) Fab YADS2 Heavy Chain

SCOPe Domain Sequences for d1tzib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tzib1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
evqlvesggglvqpggslrlscaasgfaiydydihwvrqapgkglewvadiapyagatay
adsvkgrftisadtskntaylqmnslraedtavyycsrssyayyaamdywgqgtlvtvss

SCOPe Domain Coordinates for d1tzib1:

Click to download the PDB-style file with coordinates for d1tzib1.
(The format of our PDB-style files is described here.)

Timeline for d1tzib1: