SCOP 1.73: Domain d1tzia1: 1tzi A:1-107

Lineage for d1tzia1 (1tzi A:1-107)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Engineered (including hybrid species) [88533] (52 PDB entries)

8. Domain d1tzia1: 1tzi A:1-107 [107487]
   Other proteins in same PDB: d1tzia2, d1tzib1, d1tzib2, d1tziv_

Details for d1tzia1

PDB Entry: 1tzi, 2.8 Å

PDB Description: Crystal Structure of the Fab YADS2 Complexed with h-VEGF

PDB Compounds: (A:) Fab YADS2 Light Chain

SCOP Domain Sequences for d1tzia1:

Sequence; same for both SEQRES and ATOM records:

>d1tzia1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)}
diqmtqspsslsasvgdrvtitcrasqsyayavawyqqkpgkapklliydasylysgvps
rfsgsgsgtdftltisslqpedfatyycqqaysspdtfgqgtkveik

Timeline for d1tzia1:

• d1tzia1 first appeared in SCOP 1.69
  
• d1tzia1 appears in SCOP 1.71
  
• d1tzia1 appears in SCOP 1.75
  
• d1tzia1 appears in the current release, SCOPe 2.08