Lineage for d1tzha2 (1tzh A:108-211)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2360179Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 2360180Species Human (Homo sapiens) [TaxId:9606] [88569] (151 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody
  8. 2360275Domain d1tzha2: 1tzh A:108-211 [107478]
    Other proteins in same PDB: d1tzha1, d1tzhb1, d1tzhb2, d1tzhh1, d1tzhh2, d1tzhl1, d1tzhv_, d1tzhw_

Details for d1tzha2

PDB Entry: 1tzh (more details), 2.6 Å

PDB Description: Crystal Structure of the Fab YADS1 Complexed with h-VEGF
PDB Compounds: (A:) Fab YADS1 Light Chain

SCOPe Domain Sequences for d1tzha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tzha2 b.1.1.2 (A:108-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

SCOPe Domain Coordinates for d1tzha2:

Click to download the PDB-style file with coordinates for d1tzha2.
(The format of our PDB-style files is described here.)

Timeline for d1tzha2: