Class b: All beta proteins [48724] (149 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [88569] (100 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) |
Domain d1tzha2: 1tzh A:108-211 [107478] Other proteins in same PDB: d1tzha1, d1tzhb1, d1tzhb2, d1tzhh1, d1tzhh2, d1tzhl1, d1tzhv_, d1tzhw_ |
PDB Entry: 1tzh (more details), 2.6 Å
SCOP Domain Sequences for d1tzha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tzha2 b.1.1.2 (A:108-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens)} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr
Timeline for d1tzha2: