SCOP 1.69: Domain d1tzha2: 1tzh A:108-211

Lineage for d1tzha2 (1tzh A:108-211)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88569] (78 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)

8. Domain d1tzha2: 1tzh A:108-211 [107478]
   Other proteins in same PDB: d1tzha1, d1tzhb1, d1tzhb2, d1tzhh1, d1tzhh2, d1tzhl1, d1tzhv_, d1tzhw_

Details for d1tzha2

PDB Entry: 1tzh, 2.6 Å

PDB Description: Crystal Structure of the Fab YADS1 Complexed with h-VEGF

SCOP Domain Sequences for d1tzha2:

Sequence; same for both SEQRES and ATOM records:

>d1tzha2 b.1.1.2 (A:108-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens)}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Timeline for d1tzha2:

• d1tzha2 is new in SCOP 1.69
  
• d1tzha2 appears in SCOP 1.71
  
• d1tzha2 appears in the current release, SCOPe 2.08