Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.31: ThiG-like (Pfam 05690) [110399] (1 family) shares the common phosphate-binding site with other superfamilies |
Family c.1.31.1: ThiG-like (Pfam 05690) [110400] (1 protein) |
Protein Thiazole biosynthesis protein ThiG [110401] (1 species) |
Species Bacillus subtilis [TaxId:1423] [110402] (1 PDB entry) |
Domain d1tygc_: 1tyg C: [107456] Other proteins in same PDB: d1tygb_, d1tygg_ |
PDB Entry: 1tyg (more details), 3.15 Å
SCOP Domain Sequences for d1tygc_:
Sequence, based on SEQRES records: (download)
>d1tygc_ c.1.31.1 (C:) Thiazole biosynthesis protein ThiG {Bacillus subtilis} mltiggksfqsrlllgtgkypsfdiqkeavavsesdiltfavrrmnifeasqpnfleqld lskytllpntagastaeeavriarlakasglcdmikvevigcsrsllpdpvetlkaseql leegfivlpytsddvvlarkleelgvhaimpgaspigsgqgilnplnlsfiieqakvpvi vdagigspkdaayamelgadgvllntavsgaddpvkmaramklaveagrlsyeagriplk qyg
>d1tygc_ c.1.31.1 (C:) Thiazole biosynthesis protein ThiG {Bacillus subtilis} mltiggksfqsrlllgtgkypsfdiqkeavavsesdiltfafeasqpnfleqldlskytl lpntagastaeeavriarlakasglcdmikvevigcsrsllpdpvetlkaseqlleegfi vlpytsddvvlarkleelgvhaimpgaspigsgqgilnplnlsfiieqakvpvivdagig spkdaayamelgadgvllntavsgaddpvkmaramklaveagrlsyeagriplkqyg
Timeline for d1tygc_: