Class b: All beta proteins [48724] (174 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) |
Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (15 proteins) |
Protein Streptococcal pyrogenic exotoxin Spe-J [110192] (1 species) |
Species Streptococcus pyogenes [TaxId:1314] [110193] (2 PDB entries) Uniprot Q7BAE3 |
Domain d1ty2b1: 1ty2 B:4-98 [107448] Other proteins in same PDB: d1ty2a2, d1ty2b2, d1ty2c2 complexed with zn |
PDB Entry: 1ty2 (more details), 2 Å
SCOPe Domain Sequences for d1ty2b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ty2b1 b.40.2.2 (B:4-98) Streptococcal pyrogenic exotoxin Spe-J {Streptococcus pyogenes [TaxId: 1314]} senikdvklqlnyayeiipvdytncnidyltthdfyidissykkknfsvdsevesyittk ftknqkvnifglpyiftrydvyyiyggvtpsvnsn
Timeline for d1ty2b1:
View in 3D Domains from other chains: (mouse over for more information) d1ty2a1, d1ty2a2, d1ty2c1, d1ty2c2 |