SCOPe 2.01: Domain d1ty2a2: 1ty2 A:104-211

Lineage for d1ty2a2 (1ty2 A:104-211)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (15 proteins)

6. Protein Streptococcal pyrogenic exotoxin Spe-J [110812] (1 species)

7. Species Streptococcus pyogenes [TaxId:1314] [110813] (2 PDB entries)
   Uniprot Q7BAE3

8. Domain d1ty2a2: 1ty2 A:104-211 [107447]
   Other proteins in same PDB: d1ty2a1, d1ty2b1, d1ty2c1
   complexed with zn

Details for d1ty2a2

PDB Entry: 1ty2, 2 Å

PDB Description: Crystal structure of the streptococcal pyrogenic exotoxin J (SPE-J)

PDB Compounds: (A:) putative exotoxin (superantigen)

SCOPe Domain Sequences for d1ty2a2:

Sequence; same for both SEQRES and ATOM records:

>d1ty2a2 d.15.6.1 (A:104-211) Streptococcal pyrogenic exotoxin Spe-J {Streptococcus pyogenes [TaxId: 1314]}
ivgnllidgvqqktlinpikidkpiftiqefdfkirqylmqtykiydpnspyikgqleia
ingnkhesfnlydatssstrsdifkkykdnktinmkdfshfdiylwtk

Timeline for d1ty2a2:

• d1ty2a2 first appeared in SCOP 1.69
  
• d1ty2a2 appears in SCOP 1.75
  
• d1ty2a2 appears in SCOPe 2.02
  
• d1ty2a2 appears in the current release, SCOPe 2.08