Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) |
Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (15 proteins) |
Protein Streptococcal pyrogenic exotoxin Spe-J [110812] (1 species) |
Species Streptococcus pyogenes [TaxId:1314] [110813] (2 PDB entries) Uniprot Q7BAE3 |
Domain d1ty2a2: 1ty2 A:104-211 [107447] Other proteins in same PDB: d1ty2a1, d1ty2b1, d1ty2c1 complexed with zn |
PDB Entry: 1ty2 (more details), 2 Å
SCOPe Domain Sequences for d1ty2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ty2a2 d.15.6.1 (A:104-211) Streptococcal pyrogenic exotoxin Spe-J {Streptococcus pyogenes [TaxId: 1314]} ivgnllidgvqqktlinpikidkpiftiqefdfkirqylmqtykiydpnspyikgqleia ingnkhesfnlydatssstrsdifkkykdnktinmkdfshfdiylwtk
Timeline for d1ty2a2:
View in 3D Domains from other chains: (mouse over for more information) d1ty2b1, d1ty2b2, d1ty2c1, d1ty2c2 |