Lineage for d1ty0c1 (1ty0 C:4-99)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798661Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 798735Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 799193Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (15 proteins)
  6. 799297Protein Streptococcal pyrogenic exotoxin Spe-J [110192] (1 species)
  7. 799298Species Streptococcus pyogenes [TaxId:1314] [110193] (2 PDB entries)
    Uniprot Q7BAE3
  8. 799301Domain d1ty0c1: 1ty0 C:4-99 [107444]
    Other proteins in same PDB: d1ty0a2, d1ty0b2, d1ty0c2

Details for d1ty0c1

PDB Entry: 1ty0 (more details), 1.75 Å

PDB Description: Crystal structure of the streptococcal pyrogenic exotoxin J (SPE-J)
PDB Compounds: (C:) putative exotoxin (superantigen)

SCOP Domain Sequences for d1ty0c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ty0c1 b.40.2.2 (C:4-99) Streptococcal pyrogenic exotoxin Spe-J {Streptococcus pyogenes [TaxId: 1314]}
senikdvklqlnyayeiipvdytncnidyltthdfyidissykkknfsvdsevesyittk
ftknqkvnifglpyiftrydvyyiyggvtpsvnsns

SCOP Domain Coordinates for d1ty0c1:

Click to download the PDB-style file with coordinates for d1ty0c1.
(The format of our PDB-style files is described here.)

Timeline for d1ty0c1: