Lineage for d1ty0b2 (1ty0 B:104-211)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1194674Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1195863Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 1195864Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (15 proteins)
  6. 1195977Protein Streptococcal pyrogenic exotoxin Spe-J [110812] (1 species)
  7. 1195978Species Streptococcus pyogenes [TaxId:1314] [110813] (2 PDB entries)
    Uniprot Q7BAE3
  8. 1195980Domain d1ty0b2: 1ty0 B:104-211 [107443]
    Other proteins in same PDB: d1ty0a1, d1ty0b1, d1ty0c1

Details for d1ty0b2

PDB Entry: 1ty0 (more details), 1.75 Å

PDB Description: Crystal structure of the streptococcal pyrogenic exotoxin J (SPE-J)
PDB Compounds: (B:) putative exotoxin (superantigen)

SCOPe Domain Sequences for d1ty0b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ty0b2 d.15.6.1 (B:104-211) Streptococcal pyrogenic exotoxin Spe-J {Streptococcus pyogenes [TaxId: 1314]}
ivgnllidgvqqktlinpikidkpiftiqefdfkirqylmqtykiydpnspyikgqleia
ingnkhesfnlydatssstrsdifkkykdnktinmkdfshfdiylwtk

SCOPe Domain Coordinates for d1ty0b2:

Click to download the PDB-style file with coordinates for d1ty0b2.
(The format of our PDB-style files is described here.)

Timeline for d1ty0b2: