SCOPe 2.05: Domain d1txra_: 1txr A:

Lineage for d1txra_ (1txr A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (18 proteins)

6. Protein Aminopeptidase [53205] (2 species)

7. Species Aeromonas proteolytica [TaxId:671] [53206] (17 PDB entries)
   Uniprot Q01693
   synonym: Vibrio proteolyticus

8. Domain d1txra_: 1txr A: [107430]
   complexed with bes, zn

Details for d1txra_

PDB Entry: 1txr, 2 Å

PDB Description: X-ray crystal structure of bestatin bound to AAP

PDB Compounds: (A:) Bacterial leucyl aminopeptidase

SCOPe Domain Sequences for d1txra_:

Sequence; same for both SEQRES and ATOM records:

>d1txra_ c.56.5.4 (A:) Aminopeptidase {Aeromonas proteolytica [TaxId: 671]}
mppitqqatvtawlpqvdasqitgtisslesftnrfytttsgaqasdwiasewqalsasl
pnasvkqvshsgynqksvvmtitgseapdewivigghldstigshtneqsvapgadddas
giaavtevirvlsennfqpkrsiafmayaaeevglrgsqdlanqyksegknvvsalqldm
tnykgsaqdvvfitdytdsnftqyltqlmdeylpsltygfdtcgyacsdhaswhnagypa
ampfeskfndynprihttqdtlansdptgshakkftqlglayaiemgsatg

Timeline for d1txra_:

• d1txra_ first appeared in SCOP 1.69
  
• d1txra_ appears in SCOPe 2.04
  
• d1txra_ appears in SCOPe 2.06
  
• d1txra_ appears in the current release, SCOPe 2.08