Lineage for d1twid2 (1twi D:50-313)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 570872Superfamily c.1.6: PLP-binding barrel [51419] (2 families) (S)
    circular permutation of the canonical fold: begins with an alpha helix and ends with a beta-strand
  5. 570873Family c.1.6.1: Alanine racemase-like, N-terminal domain [51420] (3 proteins)
  6. 570900Protein Diaminopimelate decarboxylase LysA [89457] (3 species)
    most similar to eukaryotic ODC
  7. 570901Species Archaeon Methanococcus jannaschii [TaxId:2190] [110347] (2 PDB entries)
  8. 570905Domain d1twid2: 1twi D:50-313 [107406]
    Other proteins in same PDB: d1twia1, d1twib1, d1twic1, d1twid1
    Structural genomics target
    complexed with lys, mg, plp

Details for d1twid2

PDB Entry: 1twi (more details), 2 Å

PDB Description: crystal structure of diaminopimelate decarboxylase from m. jannaschii in co-complex with l-lysine

SCOP Domain Sequences for d1twid2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1twid2 c.1.6.1 (D:50-313) Diaminopimelate decarboxylase LysA {Archaeon Methanococcus jannaschii}
seeqikinynryieafkrweeetgkefivayaykananlaitrllaklgcgadvvsggel
yiaklsnvpskkivfngncktkeeiimgieanirafnvdsiselilinetakelgetanv
afrinpnvnpkthpkistglkknkfgldvesgiamkaikmalemeyvnvvgvhchigsql
tdispfieetrkvmdfvvelkeegieiedvnlggglgipyykdkqiptqkdladaiintm
lkykdkvempnlilepgrslvata

SCOP Domain Coordinates for d1twid2:

Click to download the PDB-style file with coordinates for d1twid2.
(The format of our PDB-style files is described here.)

Timeline for d1twid2: