Class b: All beta proteins [48724] (176 folds) |
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies) barrel, closed; n=6, S=8; greek-key |
Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families) the barrel is decorated with additional structures |
Family b.49.2.3: Eukaryotic ODC-like [88683] (2 proteins) barrel is open with strands 4 and 5 having swapped their positions, compared to the alanine racemase barrel |
Protein Diaminopimelate decarboxylase LysA [89350] (3 species) |
Species Methanococcus jannaschii [TaxId:2190] [110245] (2 PDB entries) Uniprot Q58497 |
Domain d1twid1: 1twi D:15-49,D:314-448 [107405] Other proteins in same PDB: d1twia2, d1twib2, d1twic2, d1twid2 Structural genomics target complexed with lys, mg, plp |
PDB Entry: 1twi (more details), 2 Å
SCOPe Domain Sequences for d1twid1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1twid1 b.49.2.3 (D:15-49,D:314-448) Diaminopimelate decarboxylase LysA {Methanococcus jannaschii [TaxId: 2190]} mlgndtveikdgrffidgydaielaekfgtplyvmXgyllgkvhhiketpvtkwvmidag mndmmrpamyeayhhiinckvknekevvsiagglcessdvfgrdreldkvevgdvlaifd vgaygismannynargrprmvltskkgvflireretyadliakdivpphll
Timeline for d1twid1: