Lineage for d1twic2 (1twi C:50-313)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1817501Superfamily c.1.6: PLP-binding barrel [51419] (2 families) (S)
    circular permutation of the canonical fold: begins with an alpha helix and ends with a beta-strand
  5. 1817502Family c.1.6.1: Alanine racemase-like, N-terminal domain [51420] (3 proteins)
  6. 1817529Protein Diaminopimelate decarboxylase LysA [89457] (3 species)
    most similar to eukaryotic ODC
  7. 1817533Species Methanococcus jannaschii [TaxId:2190] [110347] (2 PDB entries)
    Uniprot Q58497
  8. 1817536Domain d1twic2: 1twi C:50-313 [107404]
    Other proteins in same PDB: d1twia1, d1twib1, d1twic1, d1twid1
    Structural genomics target
    complexed with lys, mg, plp

Details for d1twic2

PDB Entry: 1twi (more details), 2 Å

PDB Description: crystal structure of diaminopimelate decarboxylase from m. jannaschii in co-complex with l-lysine
PDB Compounds: (C:) diaminopimelate decarboxylase

SCOPe Domain Sequences for d1twic2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1twic2 c.1.6.1 (C:50-313) Diaminopimelate decarboxylase LysA {Methanococcus jannaschii [TaxId: 2190]}
seeqikinynryieafkrweeetgkefivayaykananlaitrllaklgcgadvvsggel
yiaklsnvpskkivfngncktkeeiimgieanirafnvdsiselilinetakelgetanv
afrinpnvnpkthpkistglkknkfgldvesgiamkaikmalemeyvnvvgvhchigsql
tdispfieetrkvmdfvvelkeegieiedvnlggglgipyykdkqiptqkdladaiintm
lkykdkvempnlilepgrslvata

SCOPe Domain Coordinates for d1twic2:

Click to download the PDB-style file with coordinates for d1twic2.
(The format of our PDB-style files is described here.)

Timeline for d1twic2: