Class b: All beta proteins [48724] (144 folds) |
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies) barrel, closed; n=6, S=8; greek-key |
Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families) the barrel is decorated with additional structures |
Family b.49.2.3: Eukaryotic ODC-like [88683] (2 proteins) barrel is open with strands 4 and 5 having swapped their positions, compared to the alanine racemase barrel |
Protein Diaminopimelate decarboxylase LysA [89350] (3 species) |
Species Archaeon Methanococcus jannaschii [TaxId:2190] [110245] (2 PDB entries) |
Domain d1twia1: 1twi A:15-49,A:314-448 [107399] Other proteins in same PDB: d1twia2, d1twib2, d1twic2, d1twid2 |
PDB Entry: 1twi (more details), 2 Å
SCOP Domain Sequences for d1twia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1twia1 b.49.2.3 (A:15-49,A:314-448) Diaminopimelate decarboxylase LysA {Archaeon Methanococcus jannaschii} mlgndtveikdgrffidgydaielaekfgtplyvmXgyllgkvhhiketpvtkwvmidag mndmmrpamyeayhhiinckvknekevvsiagglcessdvfgrdreldkvevgdvlaifd vgaygismannynargrprmvltskkgvflireretyadliakdivpphll
Timeline for d1twia1: