Lineage for d1tw9f2 (1tw9 F:1-77)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 584500Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 584501Superfamily c.47.1: Thioredoxin-like [52833] (16 families) (S)
  5. 584721Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins)
  6. 585063Protein Class sigma GST [81362] (5 species)
  7. 585067Species Heligmosomoides polygyrus [TaxId:6339] [110608] (1 PDB entry)
  8. 585073Domain d1tw9f2: 1tw9 F:1-77 [107392]
    Other proteins in same PDB: d1tw9a1, d1tw9b1, d1tw9c1, d1tw9d1, d1tw9e1, d1tw9f1, d1tw9g1, d1tw9h1

Details for d1tw9f2

PDB Entry: 1tw9 (more details), 1.71 Å

PDB Description: Glutathione Transferase-2, apo form, from the nematode Heligmosomoides polygyrus

SCOP Domain Sequences for d1tw9f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tw9f2 c.47.1.5 (F:1-77) Class sigma GST {Heligmosomoides polygyrus}
mvhykltyfngrgagecarqvfaladqkyedvrltqetfvplkatfpfgqvpvlevdgqq
laqsqaicrylaktfgf

SCOP Domain Coordinates for d1tw9f2:

Click to download the PDB-style file with coordinates for d1tw9f2.
(The format of our PDB-style files is described here.)

Timeline for d1tw9f2: