SCOP 1.69: Domain d1tw9b1: 1tw9 B:78-206

Lineage for d1tw9b1 (1tw9 B:78-206)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)

6. Protein Class sigma GST [81351] (5 species)

7. Species Heligmosomoides polygyrus [TaxId:6339] [109834] (1 PDB entry)

8. Domain d1tw9b1: 1tw9 B:78-206 [107383]
   Other proteins in same PDB: d1tw9a2, d1tw9b2, d1tw9c2, d1tw9d2, d1tw9e2, d1tw9f2, d1tw9g2, d1tw9h2

Details for d1tw9b1

PDB Entry: 1tw9, 1.71 Å

PDB Description: Glutathione Transferase-2, apo form, from the nematode Heligmosomoides polygyrus

SCOP Domain Sequences for d1tw9b1:

Sequence, based on SEQRES records:

>d1tw9b1 a.45.1.1 (B:78-206) Class sigma GST {Heligmosomoides polygyrus}
agatpfesalidsladaytdyraemktyyytalgfmtgdvdkpktdvllpartkflgfit
kflkknssgflvgdkiswvdllvaehvadmtnrvpeyiegfpevkahmeriqqtprikkw
ietrpetpf

Sequence, based on observed residues (ATOM records):

>d1tw9b1 a.45.1.1 (B:78-206) Class sigma GST {Heligmosomoides polygyrus}
agatpfesalidsladaytdyraemktdvllpartkflgfitkflkknssgflvgdkisw
vdllvaehvadmtnrvpeyiegfpevkahmeriqqtprikkwietrpetpf

Timeline for d1tw9b1:

• d1tw9b1 is new in SCOP 1.69
  
• d1tw9b1 appears in SCOP 1.71
  
• d1tw9b1 appears in the current release, SCOPe 2.08