Lineage for d1tw9a1 (1tw9 A:78-206)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 443394Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 443395Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 443396Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)
  6. 443722Protein Class sigma GST [81351] (5 species)
  7. 443726Species Heligmosomoides polygyrus [TaxId:6339] [109834] (1 PDB entry)
  8. 443727Domain d1tw9a1: 1tw9 A:78-206 [107381]
    Other proteins in same PDB: d1tw9a2, d1tw9b2, d1tw9c2, d1tw9d2, d1tw9e2, d1tw9f2, d1tw9g2, d1tw9h2

Details for d1tw9a1

PDB Entry: 1tw9 (more details), 1.71 Å

PDB Description: Glutathione Transferase-2, apo form, from the nematode Heligmosomoides polygyrus

SCOP Domain Sequences for d1tw9a1:

Sequence, based on SEQRES records: (download)

>d1tw9a1 a.45.1.1 (A:78-206) Class sigma GST {Heligmosomoides polygyrus}
agatpfesalidsladaytdyraemktyyytalgfmtgdvdkpktdvllpartkflgfit
kflkknssgflvgdkiswvdllvaehvadmtnrvpeyiegfpevkahmeriqqtprikkw
ietrpetpf

Sequence, based on observed residues (ATOM records): (download)

>d1tw9a1 a.45.1.1 (A:78-206) Class sigma GST {Heligmosomoides polygyrus}
agatpfesalidsladaytdyraemdkpktdvllpartkflgfitkflkknssgflvgdk
iswvdllvaehvadmtnrvpeyiegfpevkahmeriqqtprikkwietrpetpf

SCOP Domain Coordinates for d1tw9a1:

Click to download the PDB-style file with coordinates for d1tw9a1.
(The format of our PDB-style files is described here.)

Timeline for d1tw9a1: