SCOPe 2.01: Domain d1tw3a2: 1tw3 A:99-351

Lineage for d1tw3a2 (1tw3 A:99-351)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families)

5. Family c.66.1.12: Plant O-methyltransferase, C-terminal domain [64111] (5 proteins)

6. Protein Carminomycin 4-O-methyltransferase [110660] (1 species)

7. Species Streptomyces peucetius [TaxId:1950] [110661] (2 PDB entries)
   Uniprot Q06528

8. Domain d1tw3a2: 1tw3 A:99-351 [107374]
   Other proteins in same PDB: d1tw3a1, d1tw3b1
   complexed with ert, sah

Details for d1tw3a2

PDB Entry: 1tw3, 2.35 Å

PDB Description: crystal structure of carminomycin-4-o-methyltransferase (dnrk) in complex with s-adenosyl-l-homocystein (sah) and 4-methoxy-e- rhodomycin t (m-et)

PDB Compounds: (A:) Carminomycin 4-O-methyltransferase

SCOPe Domain Sequences for d1tw3a2:

Sequence; same for both SEQRES and ATOM records:

>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]}
paaqrawhdltqavaradisftrlpdairtgrptyesiygkpfyedlagrpdlrasfdsl
lacdqdvafdapaaaydwtnvrhvldvgggkggfaaaiarraphvsatvlemagtvdtar
sylkdeglsdrvdvvegdffeplprkadaiilsfvllnwpdhdavriltrcaealepggr
iliherddlhensfneqfteldlrmlvflggalrtrekwdglaasaglvveevrqlpspt
ipydlsllvlapa

Timeline for d1tw3a2:

• d1tw3a2 first appeared in SCOP 1.69
  
• d1tw3a2 appears in SCOP 1.75
  
• d1tw3a2 appears in SCOPe 2.02
  
• d1tw3a2 appears in the current release, SCOPe 2.08