Lineage for d1tvfb2 (1tvf B:15-315)

  1. Root: SCOP 1.69
  2. 517079Class e: Multi-domain proteins (alpha and beta) [56572] (46 folds)
  3. 517216Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 517217Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (2 families) (S)
  5. 517218Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (12 proteins)
  6. 517493Protein Pencillin binding protein 4 (PbpD), N-terminal domain [111287] (1 species)
  7. 517494Species Staphylococcus aureus [TaxId:1280] [111288] (1 PDB entry)
  8. 517496Domain d1tvfb2: 1tvf B:15-315 [107361]
    Other proteins in same PDB: d1tvfa1, d1tvfb1
    Structural genomics target

Details for d1tvfb2

PDB Entry: 1tvf (more details), 2 Å

PDB Description: crystal structure of penicillin-binding protein 4 (pbp4) from staphylococcus aureus

SCOP Domain Sequences for d1tvfb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tvfb2 e.3.1.1 (B:15-315) Pencillin binding protein 4 (PbpD), N-terminal domain {Staphylococcus aureus}
gphtssyaqatnsdvtpvqaanqygyaglsaayeptsavnvsqtgqllyqynidtkwnpa
smtklmtmyltleavnkgqlslddtvtmtnkeyimstlpelsntklypgqvwtiadllqi
tvsnssnaaalilakkvskntsdfvdlmnnkakaigmknthfvnptgaensrlrsfaptk
ykdqertvttardyaildlhviketpkildftkqlaptthavtyytfnfslegakmslpg
tdglktgssdtanynhtittkrgkfrinqvimgagdyknlggekqrnmmgnalmersfdq
y

SCOP Domain Coordinates for d1tvfb2:

Click to download the PDB-style file with coordinates for d1tvfb2.
(The format of our PDB-style files is described here.)

Timeline for d1tvfb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tvfb1