Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) |
Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
Protein Homoserine dehydrogenase [51815] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51816] (4 PDB entries) Uniprot P31116 |
Domain d1tveb1: 1tve B:2-150,B:341-359 [107356] Other proteins in same PDB: d1tvea2, d1tveb2 complexed with 178 |
PDB Entry: 1tve (more details), 3 Å
SCOP Domain Sequences for d1tveb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tveb1 c.2.1.3 (B:2-150,B:341-359) Homoserine dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} stkvvnvavigagvvgsafldqllamkstitynlvllaeaersliskdfsplnvgsdwka alaasttktlplddliahlktspkpvilvdntssayiagfytkfvengisiatpnkkafs sdlatwkalfsnkptngfvyheatvgaglXaavtaagvlgdvikiaqrl
Timeline for d1tveb1: