SCOP 1.75: Domain d1tveb1: 1tve B:2-150,B:341-359

Lineage for d1tveb1 (1tve B:2-150,B:341-359)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Homoserine dehydrogenase [51815] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51816] (4 PDB entries)
   Uniprot P31116

8. Domain d1tveb1: 1tve B:2-150,B:341-359 [107356]
   Other proteins in same PDB: d1tvea2, d1tveb2
   complexed with 178

Details for d1tveb1

PDB Entry: 1tve, 3 Å

PDB Description: Homoserine Dehydrogenase in complex with 4-(4-hydroxy-3-isopropylphenylthio)-2-isopropylphenol

PDB Compounds: (B:) homoserine dehydrogenase

SCOP Domain Sequences for d1tveb1:

Sequence; same for both SEQRES and ATOM records:

>d1tveb1 c.2.1.3 (B:2-150,B:341-359) Homoserine dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
stkvvnvavigagvvgsafldqllamkstitynlvllaeaersliskdfsplnvgsdwka
alaasttktlplddliahlktspkpvilvdntssayiagfytkfvengisiatpnkkafs
sdlatwkalfsnkptngfvyheatvgaglXaavtaagvlgdvikiaqrl

Timeline for d1tveb1:

• d1tveb1 first appeared in SCOP 1.69
  
• d1tveb1 appears in SCOP 1.73
  
• d1tveb1 appears in SCOPe 2.01
  
• d1tveb1 appears in the current release, SCOPe 2.08