Class g: Small proteins [56992] (98 folds) |
Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (2 families) automatically mapped to Pfam PF02748 |
Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein) |
Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (3 species) |
Species Escherichia coli [TaxId:562] [57828] (63 PDB entries) Uniprot P00478 |
Domain d1tugb2: 1tug B:101-153 [107341] Other proteins in same PDB: d1tuga1, d1tugb1, d1tugc1, d1tugd1 complexed with ctp, mli, pct, zn; mutant |
PDB Entry: 1tug (more details), 2.1 Å
SCOPe Domain Sequences for d1tugb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tugb2 g.41.7.1 (B:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli [TaxId: 562]} eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan
Timeline for d1tugb2:
View in 3D Domains from other chains: (mouse over for more information) d1tuga1, d1tugc1, d1tugd1, d1tugd2 |