![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies) barrel, closed; n=6, S=8; greek-key |
![]() | Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families) ![]() the barrel is decorated with additional structures |
![]() | Family b.49.2.3: Eukaryotic ODC-like [88683] (2 proteins) barrel is open with strands 4 and 5 having swapped their positions, compared to the alanine racemase barrel |
![]() | Protein Diaminopimelate decarboxylase LysA [89350] (3 species) |
![]() | Species Methanococcus jannaschii [TaxId:2190] [110245] (2 PDB entries) Uniprot Q58497 |
![]() | Domain d1tufb1: 1tuf B:15-49,B:314-448 [107337] Other proteins in same PDB: d1tufa2, d1tufb2 Structural genomics target complexed with az1 |
PDB Entry: 1tuf (more details), 2.4 Å
SCOPe Domain Sequences for d1tufb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tufb1 b.49.2.3 (B:15-49,B:314-448) Diaminopimelate decarboxylase LysA {Methanococcus jannaschii [TaxId: 2190]} flgndtveikdgrffidgydaielaekfgtplyvmXgyllgkvhhiketpvtkwvmidag mndmmrpamyeayhhiinckvknekevvsiagglcessdvfgrdreldkvevgdvlaifd vgaygismannynargrprmvltskkgvflireretyadliakdivpphll
Timeline for d1tufb1: