Lineage for d1tufa1 (1tuf A:15-49,A:314-448)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 562760Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 562853Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families) (S)
    the barrel is decorated with additional structures
  5. 562881Family b.49.2.3: Eukaryotic ODC-like [88683] (2 proteins)
    barrel is open with strands 4 and 5 having swapped their positions, compared to the alanine racemase barrel
  6. 562882Protein Diaminopimelate decarboxylase LysA [89350] (3 species)
  7. 562883Species Archaeon Methanococcus jannaschii [TaxId:2190] [110245] (2 PDB entries)
  8. 562888Domain d1tufa1: 1tuf A:15-49,A:314-448 [107335]
    Other proteins in same PDB: d1tufa2, d1tufb2

Details for d1tufa1

PDB Entry: 1tuf (more details), 2.4 Å

PDB Description: crystal structure of diaminopimelate decarboxylase from m. jannaschi

SCOP Domain Sequences for d1tufa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tufa1 b.49.2.3 (A:15-49,A:314-448) Diaminopimelate decarboxylase LysA {Archaeon Methanococcus jannaschii}
flgndtveikdgrffidgydaielaekfgtplyvmXgyllgkvhhiketpvtkwvmidag
mndmmrpamyeayhhiinckvknekevvsiagglcessdvfgrdreldkvevgdvlaifd
vgaygismannynargrprmvltskkgvflireretyadliakdivpphll

SCOP Domain Coordinates for d1tufa1:

Click to download the PDB-style file with coordinates for d1tufa1.
(The format of our PDB-style files is described here.)

Timeline for d1tufa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tufa2