SCOPe 2.06: Domain d1ttua1: 1ttu A:542-660

Lineage for d1ttua1 (1ttu A:542-660)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (8 proteins)
   subgroup of the larger IPT/TIG domain family

6. Protein DNA-binding protein LAG-1 (CSL) [110052] (1 species)

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [110053] (4 PDB entries)
   Uniprot Q9TYY1 195-660

8. Domain d1ttua1: 1ttu A:542-660 [107305]
   Other proteins in same PDB: d1ttua2, d1ttua3
   protein/DNA complex; complexed with edo

Details for d1ttua1

PDB Entry: 1ttu, 2.85 Å

PDB Description: Crystal Structure of CSL bound to DNA

PDB Compounds: (A:) lin-12 And Glp-1 transcriptional regulator

SCOPe Domain Sequences for d1ttua1:

Sequence; same for both SEQRES and ATOM records:

>d1ttua1 b.1.18.1 (A:542-660) DNA-binding protein LAG-1 (CSL) {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
dkaeyrffeamgqvanpispcpvvgslevdghgeasrvelhgrdfkpnlkvwfgatpvet
tfrseeslhcsippvsqvrneqthwmftnrttgdvevpislvrddgvvyssgltfsyks

Timeline for d1ttua1:

• d1ttua1 first appeared in SCOP 1.69
  
• d1ttua1 appears in SCOPe 2.05
  
• d1ttua1 appears in SCOPe 2.07
  
• d1ttua1 appears in the current release, SCOPe 2.08