Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (2 families) automatically mapped to Pfam PF01948 |
Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein) |
Protein Aspartate carbamoyltransferase [54895] (3 species) |
Species Escherichia coli [TaxId:562] [54896] (62 PDB entries) Uniprot P00478 |
Domain d1tthd1: 1tth D:1-100 [107301] Other proteins in same PDB: d1ttha2, d1ttha3, d1tthb2, d1tthc2, d1tthc3, d1tthd2 complexed with pal, zn; mutant |
PDB Entry: 1tth (more details), 2.8 Å
SCOPe Domain Sequences for d1tthd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tthd1 d.58.2.1 (D:1-100) Aspartate carbamoyltransferase {Escherichia coli [TaxId: 562]} mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik ientflsedqvdqlalyapqatvnridnyevvgksrpslp
Timeline for d1tthd1: