Lineage for d1tt4b_ (1tt4 B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2214217Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 2214218Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) (S)
  5. 2214444Family d.128.1.3: Glutamate-cysteine ligase family 2 (GCS2) [111160] (1 protein)
    Pfam PF04107; structural and functional relationships to Glutamine synthetase
  6. 2214445Protein Carboxylate-amine ligase YbdK [111161] (2 species)
  7. 2214449Species Salmonella typhimurium [TaxId:90371] [111163] (1 PDB entry)
    Uniprot Q8ZR41
  8. 2214451Domain d1tt4b_: 1tt4 B: [107290]
    Structural genomics target
    complexed with mg, so4

Details for d1tt4b_

PDB Entry: 1tt4 (more details), 2.8 Å

PDB Description: Structure of NP459575, a predicted glutathione synthase from Salmonella typhimurium
PDB Compounds: (B:) putative cytoplasmic protein

SCOPe Domain Sequences for d1tt4b_:

Sequence, based on SEQRES records: (download)

>d1tt4b_ d.128.1.3 (B:) Carboxylate-amine ligase YbdK {Salmonella typhimurium [TaxId: 90371]}
dfhvsepytlgielemqvinppgydlsqdsstlidavkpqltageikhditesmlematg
vcrdidqaaaqlsamqhvilqaasehhlgicgggthpfqkwqrqevcdneryqrtlenfg
yliqqatvfgqhvhvgcangddaiyllhglshfvphfialsaaspymqgadtrfacarln
ifsafpdngpmpwvsnwqefaglfrrlsyttmidsikdlhwdirpspafgtvevrvmdtp
ltldhainmagliqatahwllterpfkpqeqdyllykfnrfqacryglegvltdaytgdr
rrladdtlrlldnvtpsarklgadsaidalrlqvkkggneaqymrefiadggsliglvqk
hceiwa

Sequence, based on observed residues (ATOM records): (download)

>d1tt4b_ d.128.1.3 (B:) Carboxylate-amine ligase YbdK {Salmonella typhimurium [TaxId: 90371]}
dfhvsepytlgielemqvinppgydlsqdsstlidavkpqltageikhditesmlematg
vcrdidqaaaqlsamqhvilqaasehhlgicgggthpfqkwrtlenfgyliqqatvfgqh
vhvgcangddaiyllhglshfvphfialsaaspymqgadtrfacarlnifsafpdngpmp
wvsnwqefaglfrrlsyttmidsikdlhwdirpspafgtvevrvmdtpltldhainmagl
iqatahwllterpfkpqeqdyllykfnrfqacryglegvltdaytgdrrrladdtlrlld
nvtpsarklgadsaidalrlqvkkggneaqymrefiadggsliglvqkhceiwa

SCOPe Domain Coordinates for d1tt4b_:

Click to download the PDB-style file with coordinates for d1tt4b_.
(The format of our PDB-style files is described here.)

Timeline for d1tt4b_: