Lineage for d1tr0r_ (1tr0 R:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2193227Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2193296Family d.58.4.4: Plant stress-induced protein [89927] (3 proteins)
    automatically mapped to Pfam PF07876
  6. 2193297Protein Boiling stable protein 1 [110953] (1 species)
  7. 2193298Species European aspen (Populus tremula) [TaxId:113636] [110954] (2 PDB entries)
    Uniprot Q9AR79
  8. 2193315Domain d1tr0r_: 1tr0 R: [107277]
    complexed with gol

Details for d1tr0r_

PDB Entry: 1tr0 (more details), 1.8 Å

PDB Description: Crystal Structure of a boiling stable protein SP1
PDB Compounds: (R:) stable protein 1

SCOPe Domain Sequences for d1tr0r_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tr0r_ d.58.4.4 (R:) Boiling stable protein 1 {European aspen (Populus tremula) [TaxId: 113636]}
trtpklvkhtlltrfkdeitreqidnyindytnlldlipsmksfnwgtdlgmesaelnrg
ythafestfesksglqeyldsaalaafaegflptlsqrlvidyfly

SCOPe Domain Coordinates for d1tr0r_:

Click to download the PDB-style file with coordinates for d1tr0r_.
(The format of our PDB-style files is described here.)

Timeline for d1tr0r_: