SCOPe 2.08: Domain d1tqla_: 1tql A:

Lineage for d1tqla_ (1tql A:)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins)

6. Protein Viral RNA polymerase [56695] (17 species)

7. Species Poliovirus type 1, strain Mahoney [TaxId:12080] [56696] (12 PDB entries)
   Uniprot P03300 1748-2208

8. Domain d1tqla_: 1tql A: [107235]
   complexed with acy; mutant
   missing some secondary structures that made up less than one-third of the common domain

Details for d1tqla_

PDB Entry: 1tql, 2.3 Å

PDB Description: poliovirus polymerase g1a mutant

PDB Compounds: (A:) RNA-directed RNA polymerase

SCOPe Domain Sequences for d1tqla_:

Sequence; same for both SEQRES and ATOM records:

>d1tqla_ e.8.1.4 (A:) Viral RNA polymerase {Poliovirus type 1, strain Mahoney [TaxId: 12080]}
aeiqwmrpskevgypiinapsktklepsafhyvfegvkepavltkndprlktdfeeaifs
kyvgnkitevdeymkeavdhyagqlmsldinteqmcledamygtdglealdlstsagypy
vamgkkkrdilnkqtrdtkemqklldtyginlplvtyvkdelrsktkveqgksrlieass
lndsvamrmafgnlyaafhknpgvitgsavgcdpdlfwskipvlmeeklfafdytgydas
lspawfealkmvlekigfgdrvdyidylnhshhlyknktycvkggmpsgcsgtsifnsmi
nnliirtlllktykgidldhlkmiaygddviasyphevdasllaqsgkdygltmtpadks
atfetvtwenvtflkrffradekypflihpvmpmkeihesirwtkdprntqdhvrslcll
awhngeeeynkflakirsvpigraldlpeystlydrwldsf

Timeline for d1tqla_:

• d1tqla_ first appeared in SCOP 1.69
  
• d1tqla_ appears in SCOPe 2.07