SCOP 1.71: Domain d1tqcc2: 1tqc C:108-214

Lineage for d1tqcc2 (1tqc C:108-214)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (302 PDB entries)

8. Domain d1tqcc2: 1tqc C:108-214 [107221]
   Other proteins in same PDB: d1tqca_, d1tqcb1, d1tqcc1
   MQ P01631 P01837 #
   natural chimera

Details for d1tqcc2

PDB Entry: 1tqc, 2.8 Å

PDB Description: Ovine recombinant PrP(114-234), ARR variant in complex with the VRQ14 Fab fragment (IgG2a)

SCOP Domain Sequences for d1tqcc2:

Sequence; same for both SEQRES and ATOM records:

>d1tqcc2 b.1.1.2 (C:108-214) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d1tqcc2:

• d1tqcc2 first appeared in SCOP 1.69
  
• d1tqcc2 appears in SCOP 1.73
  
• d1tqcc2 appears in the current release, SCOPe 2.08