| Class b: All beta proteins [48724] (149 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
| Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [88576] (302 PDB entries) |
| Domain d1tqcc2: 1tqc C:108-214 [107221] Other proteins in same PDB: d1tqca_, d1tqcb1, d1tqcc1 MQ P01631 P01837 # natural chimera |
PDB Entry: 1tqc (more details), 2.8 Å
SCOP Domain Sequences for d1tqcc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tqcc2 b.1.1.2 (C:108-214) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d1tqcc2: