Lineage for d1tqcc2 (1tqc C:108-214)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 453267Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 453396Species Mouse (Mus musculus) [TaxId:10090] [88576] (295 PDB entries)
  8. 453768Domain d1tqcc2: 1tqc C:108-214 [107221]
    Other proteins in same PDB: d1tqca_, d1tqcb1, d1tqcc1

Details for d1tqcc2

PDB Entry: 1tqc (more details), 2.8 Å

PDB Description: Ovine recombinant PrP(114-234), ARR variant in complex with the VRQ14 Fab fragment (IgG2a)

SCOP Domain Sequences for d1tqcc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tqcc2 b.1.1.2 (C:108-214) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1tqcc2:

Click to download the PDB-style file with coordinates for d1tqcc2.
(The format of our PDB-style files is described here.)

Timeline for d1tqcc2: