SCOP 1.69: Domain d1tqcb1: 1tqc B:1-113

Lineage for d1tqcb1 (1tqc B:1-113)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88554] (32 PDB entries)

8. Domain d1tqcb1: 1tqc B:1-113 [107218]
   Other proteins in same PDB: d1tqca_, d1tqcb2, d1tqcc2

Details for d1tqcb1

PDB Entry: 1tqc, 2.8 Å

PDB Description: Ovine recombinant PrP(114-234), ARR variant in complex with the VRQ14 Fab fragment (IgG2a)

SCOP Domain Sequences for d1tqcb1:

Sequence; same for both SEQRES and ATOM records:

>d1tqcb1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4}
qiqlvqsgpelkkpgetvkisckasgytftnygmnlvkqapgkgfewmgwintftgepty
addfkgrfvfsldtsastaylqinnlknedtatyfftrgtdywgqgttltvss

Timeline for d1tqcb1:

• d1tqcb1 is new in SCOP 1.69
  
• d1tqcb1 appears in SCOP 1.71
  
• d1tqcb1 appears in the current release, SCOPe 2.08