Lineage for d1tqca_ (1tqc A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 597694Fold d.6: Prion-like [54097] (1 superfamily)
    beta-alpha-beta-alpha(2); antiparallel beta-ribbon
  4. 597695Superfamily d.6.1: Prion-like [54098] (1 family) (S)
  5. 597696Family d.6.1.1: Prion-like [54099] (2 proteins)
  6. 597697Protein Prion protein domain [54100] (12 species)
  7. 597742Species Sheep (Ovis aries) [TaxId:9940] [102729] (6 PDB entries)
  8. 597748Domain d1tqca_: 1tqc A: [107217]
    Other proteins in same PDB: d1tqcb1, d1tqcb2, d1tqcc1, d1tqcc2

Details for d1tqca_

PDB Entry: 1tqc (more details), 2.8 Å

PDB Description: Ovine recombinant PrP(114-234), ARR variant in complex with the VRQ14 Fab fragment (IgG2a)

SCOP Domain Sequences for d1tqca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tqca_ d.6.1.1 (A:) Prion protein domain {Sheep (Ovis aries)}
glggymlgsamsrplihfgndyedryyrenmyrypnqvyyrpvdrysnqnnfvhdcvnit
vkqhtvttttkgenftetdikimervveqmcitqyqresqay

SCOP Domain Coordinates for d1tqca_:

Click to download the PDB-style file with coordinates for d1tqca_.
(The format of our PDB-style files is described here.)

Timeline for d1tqca_: