Lineage for d1tqbc1 (1tqb C:1-107)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 450780Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)
  6. 450916Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 451404Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88554] (32 PDB entries)
  8. 451447Domain d1tqbc1: 1tqb C:1-107 [107215]
    Other proteins in same PDB: d1tqba_, d1tqbb2, d1tqbc2

Details for d1tqbc1

PDB Entry: 1tqb (more details), 2.55 Å

PDB Description: Ovine recombinant PrP(114-234), VRQ variant in complex with the Fab of the VRQ14 antibody

SCOP Domain Sequences for d1tqbc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tqbc1 b.1.1.1 (C:1-107) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4}
dvvmsqtpltlsvtigqpasisckssqslldsdgktylnwllqrpgqspkrliylvsrld
sgvpdrftgsgsgtdftlkisrveaedlgiyfcwqgshfpqtfgggtkleik

SCOP Domain Coordinates for d1tqbc1:

Click to download the PDB-style file with coordinates for d1tqbc1.
(The format of our PDB-style files is described here.)

Timeline for d1tqbc1: