SCOP 1.73: Domain d1tqbb2: 1tqb B:114-223

Lineage for d1tqbb2 (1tqb B:114-223)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)

8. Domain d1tqbb2: 1tqb B:114-223 [107214]
   Other proteins in same PDB: d1tqba_, d1tqbb1, d1tqbc1
   MQ P06327 P01864 #
   natural chimera

Details for d1tqbb2

PDB Entry: 1tqb, 2.55 Å

PDB Description: Ovine recombinant PrP(114-234), VRQ variant in complex with the Fab of the VRQ14 antibody

PDB Compounds: (B:) VRQ14 Fab Heavy chain

SCOP Domain Sequences for d1tqbb2:

Sequence; same for both SEQRES and ATOM records:

>d1tqbb2 b.1.1.2 (B:114-223) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkkiep

Timeline for d1tqbb2:

• d1tqbb2 first appeared in SCOP 1.69
  
• d1tqbb2 appears in SCOP 1.71
  
• d1tqbb2 appears in SCOP 1.75
  
• d1tqbb2 appears in the current release, SCOPe 2.08