![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.6: Prion-like [54097] (1 superfamily) beta-alpha-beta-alpha(2); antiparallel beta-ribbon |
![]() | Superfamily d.6.1: Prion-like [54098] (1 family) ![]() |
![]() | Family d.6.1.1: Prion-like [54099] (3 proteins) |
![]() | Protein Prion protein domain [54100] (14 species) |
![]() | Species Sheep (Ovis aries) [TaxId:9940] [102729] (6 PDB entries) Uniprot P23907 124-234 ! Uniprot P23907 122-234 ! Uniprot P23907 127-228 |
![]() | Domain d1tqba_: 1tqb A: [107212] Other proteins in same PDB: d1tqbb1, d1tqbb2, d1tqbc1, d1tqbc2 |
PDB Entry: 1tqb (more details), 2.55 Å
SCOPe Domain Sequences for d1tqba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tqba_ d.6.1.1 (A:) Prion protein domain {Sheep (Ovis aries) [TaxId: 9940]} glggymlgsvmsrplihfgndyedryyrenmyrypnqvyyrpvdqysnqnnfvhdcvnit vkqhtvttttkgenftetdikimervveqmcitqyqresqay
Timeline for d1tqba_:
![]() Domains from other chains: (mouse over for more information) d1tqbb1, d1tqbb2, d1tqbc1, d1tqbc2 |