SCOP 1.71: Domain d1tpxa_: 1tpx A:

Lineage for d1tpxa_ (1tpx A:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.6: Prion-like [54097] (1 superfamily)
   beta-alpha-beta-alpha(2); antiparallel beta-ribbon

4. Superfamily d.6.1: Prion-like [54098] (1 family)

5. Family d.6.1.1: Prion-like [54099] (2 proteins)

6. Protein Prion protein domain [54100] (12 species)

7. Species Sheep (Ovis aries) [TaxId:9940] [102729] (6 PDB entries)

8. Domain d1tpxa_: 1tpx A: [107189]
   Other proteins in same PDB: d1tpxb1, d1tpxb2, d1tpxc1, d1tpxc2

Details for d1tpxa_

PDB Entry: 1tpx, 2.56 Å

PDB Description: Ovine recombinant PrP(114-234), ARQ variant in complex with the Fab of the VRQ14 antibody

SCOP Domain Sequences for d1tpxa_:

Sequence; same for both SEQRES and ATOM records:

>d1tpxa_ d.6.1.1 (A:) Prion protein domain {Sheep (Ovis aries)}
glggymlgsamsrplihfgndyedryyrenmyrypnqvyyrpvdqysnqnnfvhdcvnit
vkqhtvttttkgenftetdikimervveqmcitqyqresqay

Timeline for d1tpxa_:

• d1tpxa_ first appeared in SCOP 1.69
  
• d1tpxa_ appears in SCOP 1.73
  
• d1tpxa_ appears in the current release, SCOPe 2.08