SCOP 1.69: Domain d1tltb2: 1tlt B:128-267

Lineage for d1tltb2 (1tlt B:128-267)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.5: Glucose 6-phosphate dehydrogenase-like [55376] (4 proteins)
   has many additional secondary structures

6. Protein Virulence factor MviM [111052] (1 species)

7. Species Escherichia coli [TaxId:562] [111053] (1 PDB entry)

8. Domain d1tltb2: 1tlt B:128-267 [107138]
   Other proteins in same PDB: d1tlta1, d1tltb1
   Structural genomics target

Details for d1tltb2

PDB Entry: 1tlt, 2.7 Å

PDB Description: crystal structure of a putative oxidoreductase (virulence factor mvim homolog)

SCOP Domain Sequences for d1tltb2:

Sequence; same for both SEQRES and ATOM records:

>d1tltb2 d.81.1.5 (B:128-267) Virulence factor MviM {Escherichia coli}
aplygelktqlataaslrmdkhrsnsvgphdlyftllddylhvvdtalwlsggkasldgg
tlltndagemlfaehhfsagplqittcmhrragsqretvqavtdgaliditdmrewreer
gqgvvhkpipgwqstleqrg

Timeline for d1tltb2:

• d1tltb2 is new in SCOP 1.69
  
• d1tltb2 appears in SCOP 1.71
  
• d1tltb2 appears in the current release, SCOPe 2.08