Lineage for d1tlta2 (1tlt A:128-267)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 506899Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 506900Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 507247Family d.81.1.5: Glucose 6-phosphate dehydrogenase-like [55376] (4 proteins)
    has many additional secondary structures
  6. 507305Protein Virulence factor MviM [111052] (1 species)
  7. 507306Species Escherichia coli [TaxId:562] [111053] (1 PDB entry)
  8. 507307Domain d1tlta2: 1tlt A:128-267 [107136]
    Other proteins in same PDB: d1tlta1, d1tltb1

Details for d1tlta2

PDB Entry: 1tlt (more details), 2.7 Å

PDB Description: crystal structure of a putative oxidoreductase (virulence factor mvim homolog)
PDB Compounds: (A:)

SCOP Domain Sequences for d1tlta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tlta2 d.81.1.5 (A:128-267) Virulence factor MviM {Escherichia coli}
aplygelktqlataaslrmdkhrsnsvgphdlyftllddylhvvdtalwlsggkasldgg
tlltndagemlfaehhfsagplqittcmhrragsqretvqavtdgaliditdmrewreer
gqgvvhkpipgwqstleqrg

SCOP Domain Coordinates for d1tlta2:

Click to download the PDB-style file with coordinates for d1tlta2.
(The format of our PDB-style files is described here.)

Timeline for d1tlta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tlta1