Lineage for d1tk8a2 (1tk8 A:211-704)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2571153Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2571154Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2571155Family e.8.1.1: DNA polymerase I [56673] (5 proteins)
  6. 2571427Protein T7 phage DNA polymerase [56678] (1 species)
  7. 2571428Species Bacteriophage T7 [TaxId:10760] [56679] (17 PDB entries)
    Uniprot P00581
  8. 2571436Domain d1tk8a2: 1tk8 A:211-704 [107080]
    Other proteins in same PDB: d1tk8a1, d1tk8b_
    protein/DNA complex; complexed with 1pe, d3t, mes, mg, so4

Details for d1tk8a2

PDB Entry: 1tk8 (more details), 2.5 Å

PDB Description: T7 DNA polymerase ternary complex with 8 oxo guanosine and dAMP at the elongation site
PDB Compounds: (A:) DNA polymerase

SCOPe Domain Sequences for d1tk8a2:

Sequence, based on SEQRES records: (download)

>d1tk8a2 e.8.1.1 (A:211-704) T7 phage DNA polymerase {Bacteriophage T7 [TaxId: 10760]}
leavdiehraawllakqerngfpfdtkaieelyvelaarrsellrkltetfgswyqpkgg
temfchprtgkplpkypriktpkvggifkkpknkaqregrepceldtreyvagapytpve
hvvfnpssrdhiqkklqeagwvptkytdkgapvvddevlegvrvddpekqaaidlikeyl
miqkrigqsaegdkawlryvaedgkihgsvnpngavtgrathafpnlaqipgvrspygeq
craafgaehhldgitgkpwvqagidasglelrclahfmarfdngeyaheilngdihtknq
iaaelptrdnaktfiygflygagdekigqivgagkergkelkkkflentpaiaalresiq
qtlvessqwvageqqvkwkrrwikgldgrkvhvrsphaalntllqsagalicklwiikte
emlvekglkhgwdgdfaymawvhdeiqvgcrteeiaqvvietaqeamrwvgdhwnfrcll
dtegkmgpnwaich

Sequence, based on observed residues (ATOM records): (download)

>d1tk8a2 e.8.1.1 (A:211-704) T7 phage DNA polymerase {Bacteriophage T7 [TaxId: 10760]}
leavdiehraawllakqerngfpfdtkaieelyvelaarrsellrkltetfgswyqpkgg
temfchprtgkplpkypriktpkvggifkkpknkaqregrepceldtreyvagapytpve
hvvfnpssrdhiqkklqeagwvptkytdkgapvvddevlegvrvddpekqaaidlikeyl
miqkrigqsaegdkawlryvaedgkihgsvnpngavtgrathafpnlaqipgvrspygeq
craafgaehhldgitgkpwvqagidasglelrclahfmarfdngeyaheilngdihtknq
iaaelptrdnaktfiygflygagdekigqivgagkergkelkkkflentpaiaalresiq
qtlvessqqvkwkrrwikgldgrkvhvrsphaalntllqsagalicklwiikteemlvek
glkhgwdgdfaymawvhdeiqvgcrteeiaqvvietaqeamrwvgdhwnfrclldtegkm
gpnwaich

SCOPe Domain Coordinates for d1tk8a2:

Click to download the PDB-style file with coordinates for d1tk8a2.
(The format of our PDB-style files is described here.)

Timeline for d1tk8a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tk8a1
View in 3D
Domains from other chains:
(mouse over for more information)
d1tk8b_