Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (15 families) |
Family c.47.1.1: Thioltransferase [52834] (11 proteins) |
Protein Thioredoxin [52835] (10 species) |
Species Escherichia coli [TaxId:562] [52836] (21 PDB entries) |
Domain d1tk5b_: 1tk5 B: [107076] Other proteins in same PDB: d1tk5a1, d1tk5a2 |
PDB Entry: 1tk5 (more details), 2.2 Å
SCOP Domain Sequences for d1tk5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tk5b_ c.47.1.1 (B:) Thioredoxin {Escherichia coli} kiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnidq npgtapkygirgiptlllfkngevaatkvgalskgqlkefldanl
Timeline for d1tk5b_: