Lineage for d1tk5b_ (1tk5 B:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 486470Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 486471Superfamily c.47.1: Thioredoxin-like [52833] (15 families) (S)
  5. 486472Family c.47.1.1: Thioltransferase [52834] (11 proteins)
  6. 486522Protein Thioredoxin [52835] (10 species)
  7. 486547Species Escherichia coli [TaxId:562] [52836] (21 PDB entries)
  8. 486554Domain d1tk5b_: 1tk5 B: [107076]
    Other proteins in same PDB: d1tk5a1, d1tk5a2

Details for d1tk5b_

PDB Entry: 1tk5 (more details), 2.2 Å

PDB Description: t7 dna polymerase binary complex with 8 oxo guanosine in the templating strand

SCOP Domain Sequences for d1tk5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tk5b_ c.47.1.1 (B:) Thioredoxin {Escherichia coli}
kiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnidq
npgtapkygirgiptlllfkngevaatkvgalskgqlkefldanl

SCOP Domain Coordinates for d1tk5b_:

Click to download the PDB-style file with coordinates for d1tk5b_.
(The format of our PDB-style files is described here.)

Timeline for d1tk5b_: