Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family) Similar in architecture to the superfamily II but partly differs in topology |
Family c.93.1.1: L-arabinose binding protein-like [53823] (16 proteins) |
Protein AI-2 receptor LsrB [110745] (1 species) |
Species Salmonella typhi [TaxId:90370] [110746] (2 PDB entries) Uniprot Q8Z2X8 27-340 |
Domain d1tjya_: 1tjy A: [107062] complexed with pav |
PDB Entry: 1tjy (more details), 1.3 Å
SCOP Domain Sequences for d1tjya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tjya_ c.93.1.1 (A:) AI-2 receptor LsrB {Salmonella typhi [TaxId: 90370]} gsaeriafipklvgvgfftsggngaqeagkalgidvtydgptepsvsgqvqlvnnfvnqg ydaiivsavspdglcpalkramqrgvkiltwdsdtkpecrsyyinqgtpkqlgsmlvema ahqvdkekakvaffyssptvtdqnqwvkeakakisqehpgweivttqfgyndatkslqta egiikaypdldaiiapdanalpaaaqaaenlkrnnlaivgfstpnvmrpyvqrgtvkefg lwdvvqqgkisvyvanallknmpmnvgdsldipgigkvtvspnseqgyhyeakgngivll pervifnkdnidkydf
Timeline for d1tjya_: