SCOP 1.75: Domain d1tjya_: 1tjy A:

Lineage for d1tjya_ (1tjy A:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.1: L-arabinose binding protein-like [53823] (16 proteins)

6. Protein AI-2 receptor LsrB [110745] (1 species)

7. Species Salmonella typhi [TaxId:90370] [110746] (2 PDB entries)
   Uniprot Q8Z2X8 27-340

8. Domain d1tjya_: 1tjy A: [107062]
   complexed with pav

Details for d1tjya_

PDB Entry: 1tjy, 1.3 Å

PDB Description: crystal structure of salmonella typhimurium ai-2 receptor lsrb in complex with r-thmf

PDB Compounds: (A:) sugar transport protein

SCOP Domain Sequences for d1tjya_:

Sequence; same for both SEQRES and ATOM records:

>d1tjya_ c.93.1.1 (A:) AI-2 receptor LsrB {Salmonella typhi [TaxId: 90370]}
gsaeriafipklvgvgfftsggngaqeagkalgidvtydgptepsvsgqvqlvnnfvnqg
ydaiivsavspdglcpalkramqrgvkiltwdsdtkpecrsyyinqgtpkqlgsmlvema
ahqvdkekakvaffyssptvtdqnqwvkeakakisqehpgweivttqfgyndatkslqta
egiikaypdldaiiapdanalpaaaqaaenlkrnnlaivgfstpnvmrpyvqrgtvkefg
lwdvvqqgkisvyvanallknmpmnvgdsldipgigkvtvspnseqgyhyeakgngivll
pervifnkdnidkydf

Timeline for d1tjya_:

• d1tjya_ first appeared in SCOP 1.69
  
• d1tjya_ appears in SCOP 1.73
  
• d1tjya_ appears in SCOPe 2.01
  
• d1tjya_ appears in the current release, SCOPe 2.08, called d1tjya1