![]() | Class g: Small proteins [56992] (75 folds) |
![]() | Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
![]() | Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (13 families) ![]() |
![]() | Family g.39.1.13: Prokaryotic DksA/TraR C4-type zinc finger (Pfam 01258) [111448] (1 protein) Pfam coverage extends to the second helix of the upstream alpha-hairpin domain |
![]() | Protein DnaK suppressor protein DksA, zinc finger domain [111449] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [111450] (1 PDB entry) |
![]() | Domain d1tjlh2: 1tjl H:111-151 [107042] Other proteins in same PDB: d1tjla1, d1tjlb1, d1tjlc1, d1tjld1, d1tjle1, d1tjlf1, d1tjlg1, d1tjlh1, d1tjli1, d1tjlj1 |
PDB Entry: 1tjl (more details), 2 Å
SCOP Domain Sequences for d1tjlh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tjlh2 g.39.1.13 (H:111-151) DnaK suppressor protein DksA, zinc finger domain {Escherichia coli} fgycescgveigirrlearptadlcidcktlaeirekqmag
Timeline for d1tjlh2: