SCOP 1.69: Domain d1ti6g1: 1ti6 G:729-875

Lineage for d1ti6g1 (1ti6 G:729-875)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
   barrel, closed; n=6, S=10; complex topology with crossover (psi) loops

4. Superfamily b.52.2: ADC-like [50692] (3 families)

5. Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (9 proteins)
   molybdopterine enzyme

6. Protein Transhydroxylase alpha subunit, AthL [110250] (1 species)

7. Species Pelobacter acidigallici [TaxId:35816] [110251] (6 PDB entries)

8. Domain d1ti6g1: 1ti6 G:729-875 [106986]
   Other proteins in same PDB: d1ti6a2, d1ti6b1, d1ti6b2, d1ti6c2, d1ti6d1, d1ti6d2, d1ti6e2, d1ti6f1, d1ti6f2, d1ti6g2, d1ti6h1, d1ti6h2, d1ti6i2, d1ti6j1, d1ti6j2, d1ti6k2, d1ti6l1, d1ti6l2

Details for d1ti6g1

PDB Entry: 1ti6, 2 Å

PDB Description: Crystal Structure of Pyrogallol-Phloroglucinol Transhydroxylase from Pelobacter acidigallici complexed with inhibitor 1,2,4,5-tetrahydroxy-benzene

SCOP Domain Sequences for d1ti6g1:

Sequence; same for both SEQRES and ATOM records:

>d1ti6g1 b.52.2.2 (G:729-875) Transhydroxylase alpha subunit, AthL {Pelobacter acidigallici}
kyplgmlsphprfsmhtmgdgknsymnyikdhrvevdgykywimrvnsidaeargikngd
lirayndrgsvilaaqvteclqpgtvhsyescavydplgtagksadrggciniltpdryi
skyacgmanntalveiekwdgdkyeiy

Timeline for d1ti6g1:

• d1ti6g1 is new in SCOP 1.69
  
• d1ti6g1 appears in SCOP 1.71
  
• d1ti6g1 appears in the current release, SCOPe 2.08